KEGG   Bacillus subtilis subsp. subtilis 168: BSU20350Help
Entry
BSU20350          CDS       T00010                                 

Gene name
yorK
Definition
(RefSeq) single-strand DNA-specific exonuclease YorK
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
bsu03430  Mismatch repair
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU20350 (yorK)
   03430 Mismatch repair
    BSU20350 (yorK)
   03440 Homologous recombination
    BSU20350 (yorK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU20350 (yorK)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU20350 (yorK)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     BSU20350 (yorK)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU20350 (yorK)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSU20350 (yorK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecJ_OB DHH DHHA1
Motif
Other DBs
NCBI-GeneID: 939545
NCBI-ProteinID: NP_389917
Pasteur: BG13695
BSORF: BG13695
UniProt: O31903
Position
complement(2179526..2181256)
Genome map
AA seq 576 aa AA seqDB search
MEYRLIGDNDYNFDPLATILKNRGIEDPKLFVNVDQSSVIHYSKLNNIDKAADCLIRHLN
NKNKLFVQVDSDVDGYTSSSIIINYIKKICPKANIHYRIQDGKEHGIFIDTIPDDVDLVI
IPDAGSSQFEEHEALNKRGTEIIVIDHHECERVSEHAIVVNNQLSPNYSNKTLTGAGMAY
KFCQAIDEKLNKNEAEQFLDLVSIGNIADSADSRNLETRYFMNEGLKKIKHPLLKKLFKK
QEFSTKGDKSIQNTQFFINPLINAAIRVGSSEEKDQMMRAFLLSKEKVPYKKRGQSETEL
VSIHEDTVRILGNLKAKQKRIVDAAGVEIKNRIEEKSLTANKVLIVYIEGILDKSLTGLV
ANQLAEEYKKPVLLARNDPEKGKDILSGSIRGYDKGFIKDFKKELIDTGLFEFVEGHPNA
AGFAIKRQNLILVNKVLNEKFKDINIEEDIQNVDFEIPAKRLRKEFILQLDGYKDYWGYK
VEEPLIAITDLEIEVEQIEHLGKKNKTTVKFKHGDIEYIRFKSDENYFNQLTASNGTLVI
NVIGKAKANEYKGKKTPQIEIYELEVVRTKQKELVF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggagtatagactaattggcgacaatgattataatttcgatcctttagctactatctta
aaaaatagaggcatagaagatccaaagttgtttgttaatgttgatcaaagttcagttatt
cattattcaaagcttaataatattgataaagctgcagattgtcttatcaggcatttaaat
aataaaaataaattgtttgttcaggtagacagtgatgttgatggatacacatccagctca
atcattataaattacataaagaagatttgtccgaaagctaatatacactacagaattcaa
gatgggaaagagcatgggatttttattgatacaattcctgatgatgttgacttagtcata
atcccagatgcaggttcaagtcaatttgaggaacatgaggctcttaataagagaggcaca
gaaataattgttattgatcaccatgaatgtgaacgagtgtctgaacatgcgatcgtagta
aataatcaactttcgcctaattattcgaataaaactctgacaggtgcaggaatggcctat
aaattttgccaggcaattgatgaaaagctaaataaaaatgaagccgaacaattcttagac
cttgtatctattggtaacattgctgattcggctgattcaagaaaccttgaaaccaggtat
tttatgaatgaaggcttgaagaaaataaaacatccattattaaagaagctgtttaagaag
caagagttttcaaccaagggtgacaagagcatacagaatacacagttctttattaaccct
ttaattaacgctgccattagggttggaagcagtgaagaaaaagatcaaatgatgagagca
ttcctcctttctaaagaaaaggttccctacaaaaaacgtgggcaaagtgaaactgagctt
gtatcaatacatgaagacacagttaggattctaggaaatctaaaagcaaagcagaaacgg
attgtagatgcagctggagtggaaattaaaaatagaatagaagagaaaagtttaacagcg
aataaagtactcattgtttacattgaaggaattctagataaaagcctaactggactggtg
gccaatcagcttgcagaagaatataaaaagccggtcttgttagccagaaacgatcccgaa
aaaggtaaagatatcttgagtggctctatacgaggatatgataaagggtttataaaggat
tttaagaaagagcttatagatactggattatttgagtttgttgaaggtcacccaaatgca
gcgggctttgcaattaaacgacagaacttaatcctggtgaacaaagtgctgaatgaaaaa
tttaaagacataaatatcgaagaagatattcagaatgttgattttgagatcccagcaaaa
cgattgagaaaagaatttatccttcaacttgatggttacaaagactattggggttacaaa
gttgaagaacccttaatagctataacggatcttgaaattgaagtcgaacaaattgagcat
ttagggaaaaagaataagacaactgttaaatttaagcatggcgatattgaatacataagg
tttaaaagtgatgagaattactttaatcagcttactgcatcaaatggaacgttagtcatt
aatgtaattggcaaagcaaaggcaaatgaatacaaaggcaagaaaacacctcaaatcgag
atttatgaattggaggtggttcgcacaaaacaaaaagaacttgtgttttaa

DBGET integrated database retrieval system