KEGG   Bacillus subtilis subsp. subtilis 168: BSU20360Help
Entry
BSU20360          CDS       T00010                                 

Gene name
yorJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939584
NCBI-ProteinID: NP_389918
Pasteur: BG13694
BSORF: BG13694
UniProt: O31904
Position
complement(2181256..2182392)
Genome map
AA seq 378 aa AA seqDB search
MKYDKDRVKESLTIEDIHKILKDLGSENNLWDQQGNPIYRTVCHNASGGSYKLYYYHEAK
QFHCYTECGDNFDVFELVIRAKSQKGINISFNQAIEYVAKIAGRTFGFGNRETYINNDLI
DDWEWMGKFKKKKKIHIELPSFNETVLDVFVPYPHQLWLGEGISHKTLKEFEIGYYFRPH
TEGITIPHRDLNNRLIGIRRRSMIKEEVDAGYKYMPLKVGNILYNHQTMMNLYGLHKTKN
SIERFKKVLIFESEKSVLKCQDFYGESNFTCAVCSSNISNFHRDILLSLGVEEVFIALDK
YRPPKEHETEEKYQEKLVEYQKKILKLAAKFTPYVRVYVLWDYEGLLDYKDSPADKGKET
LEELMRRKIEIGTDEGGI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtatgataaagacagagtaaaagaaagcctaaccattgaggatatacataagatt
ttaaaagatttaggtagcgagaacaatctgtgggatcaacaaggaaatccaatttacaga
accgtttgtcacaatgcttctggtgggagctataagctgtattactatcatgaagcaaaa
cagtttcactgttatacagagtgtggggataattttgatgtattcgaacttgttataaga
gcaaaaagccaaaaaggaattaatatctcttttaatcaggctatcgaatatgttgccaaa
atagcaggaagaacatttggatttgggaatagagagacatacataaacaatgatttgatt
gatgactgggaatggatggggaagttcaaaaagaagaaaaaaatacatattgagctcccc
agctttaatgaaacggttctagatgtatttgtgccttatcctcaccaattgtggctaggt
gagggaataagtcacaagacattaaaagagtttgagattgggtattattttagacctcat
acagaagggattaccattcctcatcgagatttaaataataggttgattggtatacgtagg
cgctcaatgattaaagaagaagttgatgcaggctataaatatatgcctttaaaagtaggc
aatatcttatataaccatcaaacaatgatgaatctatatggattacataaaacaaaaaat
tcgatagaaaggttcaagaaagtattgattttcgaatcagaaaaatcagtattaaaatgc
caagacttttacggtgaatcaaacttcacctgtgctgtttgttcaagtaatatttctaat
tttcaccgtgacattttattgtctcttggtgttgaagaagtttttattgctcttgataaa
tatcgaccaccaaaagaacatgaaacagaggagaaatatcaagaaaaactggttgaatat
cagaagaaaattctaaagctcgcagcaaaatttactccttatgttcgtgtatatgttttg
tgggattatgaaggcttactggattataaggacagcccagcggacaagggaaaggaaact
ctagaggagctaatgagaaggaaaattgagattggcacagatgaagggggaatttaa

DBGET integrated database retrieval system