KEGG   Bacillus subtilis subsp. subtilis 168: BSU20370Help
Entry
BSU20370          CDS       T00010                                 

Gene name
yorI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C DnaB
Motif
Other DBs
NCBI-GeneID: 939707
NCBI-ProteinID: NP_389919
Pasteur: BG13693
BSORF: BG13693
UniProt: O31905
Position
complement(2182408..2183922)
Genome map
AA seq 504 aa AA seqDB search
MLQDKQAIIQVLGSILKDPTILSESNKYKITSDDFPSRFHSILFFAMSNLFHQGTEVLND
VEIDGYLKDYDIQYKIFHDNKGLEYIEKIQELAVVENFDYHYKRLKKFSLLREMDGLGFD
IKEIYDESLIDPKEQEKMQEQFDKKSIDEILTAYEMKIVDIKEKFRTSSESVGIQGGEGI
NELLDSFEESPDIGVPLNSEMLTSIFRGSRKKKFYLRSSITGGGKTRNMVADACRLSATE
LYDPKKKEWVSNPWSESSTVISTEMMAEELQSLALAYISSVEEKKILRNTINEKEKQLVR
KAAKVLQESNIWFEHLPDFNIQEIERTIEKNVIKNNVEYVYFDYIHSSVTIFSEMSKKSG
VNLREDQILLLMSDKLKGLCNKYDVYMMSATQLNGDWKEAWLKGQVIDASYLRGSKAIAD
KTDAAMIILPLSKKEKDAIDPILKEGFYPEPNFVTHVFKNRGNEYDKVKVFSHINMGNMR
IKDCFTTNLDNELITVEKLNIKAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgctacaagacaaacaggcaataattcaagttttagggagcattttaaaagatcccaca
atcttgtcagagagcaataaatataagataacttcggatgattttccttcaaggtttcat
tcaatattattttttgccatgagcaacctatttcatcaaggaactgaagtattgaatgac
gttgaaatagatggatatctaaaggattacgatattcaatataaaattttccatgataat
aagggtcttgaatatatagaaaaaatacaagagttggcagttgtcgaaaactttgattac
cactataaaagattaaaaaagtttagtctgcttagagaaatggatggcttgggattcgat
attaaggaaatatatgatgaatctctgattgacccaaaagaacaagaaaagatgcaagaa
cagtttgataagaagtcgattgatgaaattttgacagcttatgaaatgaagattgtagac
ataaaagaaaaattcagaacttcatctgaaagtgtgggaatccagggtggagaaggtatt
aatgaattattggattcattcgaagagtcgccggatattggagttccattaaatagcgaa
atgcttacttcaatttttcggggatcacggaagaaaaagttctatctgcgctcaagtatt
acaggtggcggtaaaacaagaaacatggtcgctgacgcttgtcgcttaagtgcaactgaa
ctttatgatcctaaaaagaaggaatgggtatcaaacccatggagtgaaagttctacagtt
atttcaacagaaatgatggccgaagaattgcaaagtttagcacttgcctacattagtagt
gtagaagagaaaaaaatccttagaaacacaatcaatgaaaaagaaaaacaacttgttcgt
aaggctgctaaggttcttcaagagtctaacatatggttcgaacatctgcctgattttaat
attcaggagattgaaagaacaattgaaaagaacgtcattaaaaacaatgtagagtacgtt
tatttcgattatattcactcatcagtaaccattttttcagagatgagcaaaaaaagcggt
gtcaacttgagggaagaccaaattcttttacttatgtcagataagttaaaaggcttatgt
aacaaatacgatgtctatatgatgagtgcaactcagctaaatggtgattggaaagaagca
tggttaaaaggacaagtaatagatgcttcttacttgagaggaagtaaggccatcgcagat
aaaacagatgctgcaatgataattcttcctttaagtaaaaaagagaaggatgcaattgat
ccaattttaaaagaaggattttatccagagccaaattttgttacacatgtatttaaaaat
aggggaaatgagtatgacaaagttaaagtcttctcccatatcaatatgggcaacatgcgg
ataaaggactgtttcacaacaaatcttgacaatgaactaatcacagttgagaaattgaat
ataaaagcaggatga

DBGET integrated database retrieval system