KEGG   Bacillus subtilis subsp. subtilis 168: BSU20380Help
Entry
BSU20380          CDS       T00010                                 

Gene name
yorH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RING_2 Zn_ribbon_17 LcrG
Motif
Other DBs
NCBI-GeneID: 939851
NCBI-ProteinID: NP_389920
Pasteur: BG13692
BSORF: BG13692
UniProt: O31906
Position
complement(2183937..2184407)
Genome map
AA seq 156 aa AA seqDB search
MGRQVKCPYCETKLDKDSAIPYKKRYYHEKCFNTWKQESDHRKELIQYICNLYGLTSPTG
MMLKQIKEFQEEYGYKLKGIELALRYFYETLDNQPREGDGIGIVPFVYDEAKRHYIRQKA
IRKSAEDPKNHKREEITLVIKKGMRKKRGLVDISML
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttggggagacaagttaaatgtccttattgcgagaccaagttagacaaagactcagccatt
ccttataaaaaaagatattaccatgaaaagtgttttaatacctggaagcaagaatcagat
cacagaaaagagttaattcaatacatatgcaatttatatggtcttacatctccaactggc
atgatgttgaaacaaattaaagagtttcaagaggaatatgggtataagcttaaaggcatt
gaactagcgcttaggtacttttatgaaactttggataatcaacccagagaaggtgatggc
attggaatcgttccatttgtttatgatgaagcaaagcggcattacattagacaaaaagcc
atccgaaaatcagctgaagatccaaagaatcataaaagagaagaaattactttggtcata
aaaaaaggaatgagaaagaaaagagggctagttgatatctcaatgctatag

DBGET integrated database retrieval system