KEGG   Bacillus subtilis subsp. subtilis 168: BSU20390Help
Entry
BSU20390          CDS       T00010                                 

Gene name
yorG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_24 pEK499_p136 CENP-T_C EIF4E-T ApoC-I
Motif
Other DBs
NCBI-GeneID: 939865
NCBI-ProteinID: NP_389921
Pasteur: BG13691
BSORF: BG13691
UniProt: O31907
Position
complement(2184450..2185421)
Genome map
AA seq 323 aa AA seqDB search
MAIDIFNPQVSVVAKGLEGKVITIYGSNNLGKTKQSTRMKKPLYLPFEKGLNAIAGVQFM
PINSWADFKKVNKQLTKNAEKAKEMYQTIIVDEVDAFAKYATRYVCEQYDVERIKDGNDG
FGLWKEYETEVWEEINKLIGVGFTVIFIAHAAEDKKGKVYPKGDKRVLAPVIDNSDIVLY
LSSNGVDEDRKVIKSSAWLAETEEHFARSRFDYIDTYLPEFTAENLEKAIIEAVERQEQA
EGIVAVTYEEQKQNNASEELDFNSLMDQIKEIGMKLNEEGRLEEVNEITEKHLGKGVKVT
ECSRKQVGVMSVILDDLKDLLAE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgatattttcaacccacaagtttctgtagtagcaaaaggattagaaggaaaa
gttatcacaatctacggttctaacaacttaggtaaaactaagcaaagcactcggatgaag
aaaccgttatatctgccattcgaaaaaggattaaatgctattgccggtgtccaattcatg
cctatcaatagttgggctgattttaaaaaggtaaacaagcagttaaccaaaaatgctgaa
aaggccaaagagatgtatcaaacaatcattgttgatgaagtagacgcttttgctaaatat
gcgactagatatgtctgcgagcaatatgatgtagaacggattaaagatggtaatgatggg
tttggcctttggaaagagtatgaaactgaagtatgggaagaaatcaataaattaattggc
gtaggatttacggttatctttattgctcatgctgctgaagacaaaaaaggcaaagtatat
ccgaagggggataaacgagttttagctccagtaattgataacagcgatattgttctctat
ctaagttctaatggtgttgatgaagatagaaaagtaatcaaatcaagtgcttggttagct
gaaactgaagagcattttgctcgtagccgatttgattacattgacacgtatcttcctgaa
tttactgcagaaaacttagaaaaagcaattattgaggcagtcgaaagacaggagcaagca
gaaggaattgttgctgttacatacgaagagcaaaaacaaaacaacgcttcagaagaactt
gatttcaactcattaatggatcaaattaaagaaattggcatgaagcttaatgaagaaggc
cgtttagaagaagttaatgagattacagagaaacatttaggtaagggtgtaaaagttact
gagtgcagccgtaagcaagtaggtgtcatgtctgtaattctagatgatctaaaagacctt
ctagcagaataa

DBGET integrated database retrieval system