KEGG   Bacillus subtilis subsp. subtilis 168: BSU20400Help
Entry
BSU20400          CDS       T00010                                 

Gene name
yorF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 940146
NCBI-ProteinID: NP_389922
Pasteur: BG13690
BSORF: BG13690
UniProt: O31908
Position
complement(2185504..2186418)
Genome map
AA seq 304 aa AA seqDB search
MTENKTVLREASNVVTIEGTLAEVRHTEWKNGNGLNIELDIEVAPNEVHTVKGFSKYKKD
DGTDNAVAKGYQTIVSEYKSIAKHGRDEADKVRITQGKISLNEYYSHGIFKSYPQLMANF
VNRLDANEEFNPRAEFDVEVFVKNVTEEKVKGEETGRVNLNGYIPVYNGKVIPFTFVVTK
EGSQYVENNYEKGTTVNVFGKIINYKEQKVTTKVAAFGEDKKEITSITRREYLITGGNDP
YDEDSKNAFNADAIKKALTEREIYLDELKKEGNKENNKKSGFGGSAPNNKPSKPVEISDD
DLPF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaacaaaacggtattacgtgaagcatcaaacgttgtaacaattgaaggaact
ttagctgaagtacgacacactgaatggaaaaatggaaatggactaaatattgaattagac
attgaggttgcacctaacgaagtacatacagttaaaggcttttccaagtataagaaagat
gatggtactgataatgcagttgcaaaggggtaccagactattgtaagcgagtataagtca
atcgcaaaacacggtagagatgaagctgacaaagtaagaattactcaaggtaaaattagc
ttaaatgagtattattcacacgggatttttaaatcatatccacaattaatggctaacttt
gtgaacagactggatgctaatgaagaattcaatcccagagcagaatttgatgttgaggtg
tttgtaaagaacgtaaccgaagaaaaagtaaaaggggaagaaacaggtagagttaattta
aatggctatattcctgtgtacaacggaaaagtaattccttttacatttgtagtcacaaaa
gaaggctcacaatatgttgaaaataattatgaaaagggaactaccgttaacgtttttggg
aagatcattaattataaagaacaaaaagtaacaaccaaagtagcggcatttggagaagat
aagaaagaaattacttcaattacaagaagagagtatctaattacaggtggtaatgatcct
tatgatgaggatagtaagaatgcttttaatgcagatgcaattaaaaaagcgttgactgaa
agagagatttatctagacgagcttaagaaagaaggaaataaagaaaacaataaaaagtct
gggtttggtggaagtgctcctaataacaagccttcaaagccggttgaaatttcagatgat
gatctccctttctaa

DBGET integrated database retrieval system