KEGG   Bacillus subtilis subsp. subtilis 168: BSU20410Help
Entry
BSU20410          CDS       T00010                                 

Gene name
yorE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 940144
NCBI-ProteinID: NP_389923
Pasteur: BG13689
BSORF: BG13689
UniProt: O31909
Position
complement(2186440..2186811)
Genome map
AA seq 123 aa AA seqDB search
MEVLGITEKALNYYRENVKDNKTITPDQALLKMIRNVLLVKETHPERVKKRLFCTEYAYG
NMIIKVNRKKQVFEIVNKSGCFSDQNDWKFPKRRYIELSKELGIKDCKFRKITYSKKNHN
KQK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ttggaggtacttgggataacagagaaagcgttaaactattacagagaaaacgttaaagac
aacaagaccattactcctgatcaggcactgttaaagatgataaggaatgtcctacttgtc
aaagaaactcatcctgagcgagtgaaaaaacgtttattttgcacagagtacgcttacgga
aatatgataatcaaagttaacagaaaaaagcaggtatttgaaattgtaaataaatcagga
tgcttttctgaccaaaatgattggaagttcccaaaaagaaggtacatagaacttagtaaa
gaacttggaatcaaagactgcaagtttagaaaaattacatattcaaagaaaaatcacaat
aaacaaaaataa

DBGET integrated database retrieval system