KEGG   Bacillus subtilis subsp. subtilis 168: BSU20420Help
Entry
BSU20420          CDS       T00010                                 

Gene name
yorD
Definition
(RefSeq) stress response protein SCP1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XkdW MbeD_MobD CLZ
Motif
Other DBs
NCBI-GeneID: 940145
NCBI-ProteinID: NP_389924
Pasteur: BG13688
BSORF: BG13688
UniProt: P68575
Position
complement(2186985..2187299)
Genome map
AA seq 104 aa AA seqDB search
MEFKVGQDVSEIWNIHGSILPEVLMYMFPRSDESYDWEFVNDNGRHIFTAWRKSEPIPTL
EEIEKAAIELEEKKNAPKPKTLEERVADLEKQVAYLTSKVEGTN
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
gtggagtttaaagttggacaagacgtatcagaaatttggaatatccatggatcaattctt
ccggaagttttaatgtatatgttccctcgttcagacgaatcttatgattgggaatttgta
aatgacaacggaagacatatctttactgcctggagaaaaagtgaacctattcctacatta
gaggaaattgaaaaagcagcaattgagcttgaagagaagaaaaatgcacctaagccaaaa
actctcgaagaaagagttgctgatttagaaaaacaagtagcttacttaacgagtaaggtt
gaaggaacaaactaa

DBGET integrated database retrieval system