KEGG   Bacillus subtilis subsp. subtilis 168: BSU20430
Entry
BSU20430          CDS       T00010                                 

Gene name
yorC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936462
NCBI-ProteinID: NP_389925
Pasteur: BG13687
BSORF: BG13687
UniProt: O31910 A0A6M4JLF3
Position
complement(2187376..2187756)
AA seq 126 aa
MSNIISKEQDEAIKYFRNKLNLSDKDLYIPLINFELLRDKNEQYANILYELYKNDPYLFI
RALKEGYVVNQPIAFDEAIVRFFNGEELAIVHKTTGRRYNVNVKMKQLPDGFSLQTMDMW
LWSELV
NT seq 381 nt   +upstreamnt  +downstreamnt
atgtcaaacatcatttctaaagagcaagatgaagcaattaaatactttagaaacaaatta
aatttatcagacaaagacttatacataccgttgattaattttgaactacttagagacaag
aacgagcaatatgcgaacattctttatgagctgtataaaaatgatccctatttgtttatt
agagctttaaaggaaggttatgtggttaatcagccaattgcatttgatgaggccattgtg
cgattctttaatggagaagaactggctattgtacataaaacaacaggcagaagatacaat
gtaaatgtgaaaatgaagcagctgcctgatggcttttcattgcaaacaatggatatgtgg
ttgtggagtgagcttgtttga

DBGET integrated database retrieval system