KEGG   Bacillus subtilis subsp. subtilis 168: BSU20440Help
Entry
BSU20440          CDS       T00010                                 

Gene name
yorB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MEF2_binding
Motif
Other DBs
NCBI-GeneID: 939951
NCBI-ProteinID: NP_389926
Pasteur: BG13686
BSORF: BG13686
UniProt: O31911
Position
complement(2187819..2188115)
Genome map
AA seq 98 aa AA seqDB search
MSEQKLRIGEIRYEVFDDYDPLTEEYLGKNLANAYFIAQIKKENVVQVGNRKINYSSDVK
IGFDAFGEETKEKIKEYLLAAYSLIAEGAKDDGLVEYL
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcagaagcttagaatcggagaaatacggtatgaggttttcgatgattatgat
ccattaacagaggagtatttaggaaagaacctagcaaatgcttattttattgctcaaatt
aaaaaggaaaatgtagttcaagtagggaataggaaaattaattactcaagcgatgttaaa
attggttttgatgcattcggggaagaaactaaagagaaaatcaaagagtatcttctggct
gcctatagtctaatagcagaaggggctaaagacgatggtctagtagaatatttataa

DBGET integrated database retrieval system