KEGG   Bacillus subtilis subsp. subtilis 168: BSU20450Help
Entry
BSU20450          CDS       T00010                                 

Gene name
yorA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_helix NosD DUF1065
Motif
Other DBs
NCBI-GeneID: 940009
NCBI-ProteinID: NP_389927
Pasteur: BG13685
BSORF: BG13685
UniProt: O31912
Position
complement(2188204..2189964)
Genome map
AA seq 586 aa AA seqDB search
MTLLNKSIRYYVDFDQWGINAFNSNPIETTKGFNEALIYASENNFPIVEVPKGNFIIDSV
NTLNQRNPEIGGGIKIPSNMELLLDPEAVFQVNPNGYQGYSCFYIGLAENVIIRGGRIIG
DRYQHDYSLIDTDRKTHEWGFGIHVHGSKNVLIENVQISDCIGDNIWIAAHGMMNYPGMV
YTPSKSVTVRKCELKRGRRNNLATNGCEGLLVEDCDIEEAGGDTIGPQLGIDLEGYGENG
RKYDHPYELTISDCRFRKNGRGSVTAHTSGKVSIKDNYCDNVISYGYSTDVSIKGNKIIN
EGGSKEYGIDSVGVSSTETGNRIQITDNNIQGFKIGMMIRGKGVSIDNNTVKNASNCAIA
THMAEDVSISNNRIQDSDCIQIQVRNSSDIKVSNNKGKGTTSAYAIKVMDSNDVKFLNNT
FSNLYGGLYCERSQAVRIKLNDFLLSGKGYGIYWDKDSEVFLTRNEIFEPRNVAIMGAAD
MYNIRISDNQIYNCKAIIAIHLIGGSEHMVRGNEIMFNRDSDQGYGIYLNGTKKVRLIRN
DVQGIGARVLSHPFATFNASSTTLIHNTYDSGTPRLALDDTVIDYK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacattgttgaataaatccatacgatactatgttgactttgatcagtggggaataaat
gcatttaactcgaatccaattgaaacaactaaaggatttaatgaagctcttatatatgca
tcagagaacaactttcctattgttgaagttccaaaagggaattttattattgattcagta
aatacattaaatcaacgaaatcctgaaattggtgggggaattaaaatcccatcaaatatg
gagctccttttggatccagaagcagtgtttcaagttaaccctaatgggtatcagggctat
tcttgtttttatattgggcttgcagagaacgtaataattagaggaggtcgtattataggt
gaccggtatcaacatgattattctctaattgataccgatagaaaaacacatgaatgggga
tttggaatacatgttcatggaagcaaaaatgttttgattgaaaatgtacaaatctcagat
tgtattggagacaacatttggattgcagctcacggaatgatgaattacccagggatggtt
tatacgccttccaaaagtgttaccgtaagaaaatgcgaactaaaaagagggagacggaac
aatttagctactaacggttgtgaaggattattggttgaagactgtgatatagaggaagct
ggaggagatacaattggccctcaactaggtattgatttagagggctacggagaaaacgga
agaaagtatgatcatccttatgagttaacgatatcggattgcaggtttagaaaaaatggt
cgtggttcggttactgctcatacaagcggtaaagtttccatcaaagataactactgtgac
aatgttatttcatatggctacagtacagatgtgagtattaagggtaacaagataataaat
gaaggggggtctaaagagtacggaatagactctgtaggtgtttcgagcactgagactggc
aacagaattcaaataactgataacaatattcaagggtttaaaataggcatgatgattaga
gggaaaggggtatcgattgataataataccgtaaagaacgcttcaaattgtgcaatagca
acacatatggccgaagatgtttccatttcaaacaacagaatacaggacagcgattgtatt
cagatccaggtgagaaattcatcagatattaaagtaagcaataataaagggaaaggtaca
acttcagcatatgcaattaaagtgatggattcgaatgacgttaaattcttaaataatacg
ttctccaatctttacggaggtctatattgtgagagatctcaggcagtcagaattaagcta
aacgatttcttattgagtggaaaaggttacgggatatattgggataaagattcagaagtc
ttcctaacaaggaatgagatatttgaaccaagaaatgttgcaattatgggggcagctgat
atgtacaatatcagaataagtgataaccagatctataattgcaaagcaatcattgcgatc
cacttaataggcggttctgagcatatggttagaggaaatgaaattatgtttaacagagat
tcagatcaaggctatggaatatatttaaacgggacaaaaaaggttcgattaataaggaat
gatgttcaaggtattggtgcaagagtgctttcgcatccatttgcaacgtttaatgcttcc
agtacaactttaatacataatacatacgacagcggcacacctagattagccttagatgat
acagtaatcgattataaataa

DBGET integrated database retrieval system