KEGG   Bacillus subtilis subsp. subtilis 168: BSU20460
Entry
BSU20460          CDS       T00010                                 

Gene name
yoqZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gamma_PGA_hydro
Other DBs
NCBI-GeneID: 939582
NCBI-ProteinID: NP_389928
Pasteur: BG13684
BSORF: BG13684
UniProt: O31913 A0A6M4JMZ9
Position
complement(2189961..2190785)
AA seq 274 aa
MLKFKNRIVEKRVKGAEKASFGGPVLLYRTLRKVTKLYKYITDKKSFPILVTSLFALFNP
NSVLAADKYSNFEELKENESPLSYNILTTDVDRRVLILAPHGGGIEGGTSELARELSKSY
SAYLFEGLRIPGASELHITSTNFDEPQALDLLSKHDLTISIHGYASSKKHTLVGGTDREK
AAKITSLLTDAGFSAELLSEDSRLAGTNEQNIANKNSTGMSIQLEISTEQRREMFNTFTL
AGRNGTQNQVFYDYIAVLTKFINENVYCMAGVAP
NT seq 825 nt   +upstreamnt  +downstreamnt
ttgttaaagtttaaaaacagaatagtagaaaaaagagttaagggggcagagaaggcaagc
tttggcgggccagtccttctctaccgcacacttcgcaaggttacgaagctatataagtat
atcacagacaagaagtcttttccaatcctagttacttcattgtttgcattgtttaatccc
aattcagttctagctgcagataagtatagtaattttgaagagttgaaagaaaatgagtca
cctttgagctataacattctaactaccgatgttgacaggagagtgcttattctggcaccc
catggtggaggtattgaaggagggactagtgagcttgcaagagaattaagtaagtcttac
tctgcctatctatttgaaggtttaaggataccaggagcttctgagttgcatattacaagt
acgaatttcgatgaacctcaagctttagatttattgagtaagcatgatttaacaatctca
attcatgggtatgcatcaagtaagaaacacactttagttggtgggacagacagagaaaaa
gcagcaaagatcacatcattacttaccgatgcaggcttttctgcagaattactgtctgaa
gattcccgtttagcaggcacaaatgagcagaacattgctaataaaaatagcactggtatg
agtattcaacttgaaataagcactgaacaacgaagagaaatgtttaatacttttacactg
gctggacgcaatggaacgcagaatcaagttttttatgactatattgctgttctaactaaa
ttcattaatgaaaatgtgtattgtatggctggtgtagcaccatga

DBGET integrated database retrieval system