KEGG   Bacillus subtilis subsp. subtilis 168: BSU20460Help
Entry
BSU20460          CDS       T00010                                 

Gene name
yoqZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gamma_PGA_hydro
Motif
Other DBs
NCBI-GeneID: 939582
NCBI-ProteinID: NP_389928
Pasteur: BG13684
BSORF: BG13684
UniProt: O31913
Position
complement(2189961..2190785)
Genome map
AA seq 274 aa AA seqDB search
MLKFKNRIVEKRVKGAEKASFGGPVLLYRTLRKVTKLYKYITDKKSFPILVTSLFALFNP
NSVLAADKYSNFEELKENESPLSYNILTTDVDRRVLILAPHGGGIEGGTSELARELSKSY
SAYLFEGLRIPGASELHITSTNFDEPQALDLLSKHDLTISIHGYASSKKHTLVGGTDREK
AAKITSLLTDAGFSAELLSEDSRLAGTNEQNIANKNSTGMSIQLEISTEQRREMFNTFTL
AGRNGTQNQVFYDYIAVLTKFINENVYCMAGVAP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaagtttaaaaacagaatagtagaaaaaagagttaagggggcagagaaggcaagc
tttggcgggccagtccttctctaccgcacacttcgcaaggttacgaagctatataagtat
atcacagacaagaagtcttttccaatcctagttacttcattgtttgcattgtttaatccc
aattcagttctagctgcagataagtatagtaattttgaagagttgaaagaaaatgagtca
cctttgagctataacattctaactaccgatgttgacaggagagtgcttattctggcaccc
catggtggaggtattgaaggagggactagtgagcttgcaagagaattaagtaagtcttac
tctgcctatctatttgaaggtttaaggataccaggagcttctgagttgcatattacaagt
acgaatttcgatgaacctcaagctttagatttattgagtaagcatgatttaacaatctca
attcatgggtatgcatcaagtaagaaacacactttagttggtgggacagacagagaaaaa
gcagcaaagatcacatcattacttaccgatgcaggcttttctgcagaattactgtctgaa
gattcccgtttagcaggcacaaatgagcagaacattgctaataaaaatagcactggtatg
agtattcaacttgaaataagcactgaacaacgaagagaaatgtttaatacttttacactg
gctggacgcaatggaacgcagaatcaagttttttatgactatattgctgttctaactaaa
ttcattaatgaaaatgtgtattgtatggctggtgtagcaccatga

DBGET integrated database retrieval system