KEGG   Bacillus subtilis subsp. subtilis 168: BSU20470Help
Entry
BSU20470          CDS       T00010                                 

Gene name
yoqY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3604
Motif
Other DBs
NCBI-GeneID: 939509
NCBI-ProteinID: NP_389929
Pasteur: BG13683
BSORF: BG13683
UniProt: O31914
Position
complement(2190884..2191279)
Genome map
AA seq 131 aa AA seqDB search
MNLYEIMLEHFAPKGSERGIFTYLLAQSDEEVYEWLKTDPSLSDGRAVYTPYQDNEANGK
TYAIYNQSFDIVGHEKYKDRMIRLKGELNDEVELTDLYYGMTLVGWSMVKSDIPSEQIEL
LKDTGISIESA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatatgaaattatgttagagcactttgcacccaagggaagtgagcggggtatc
tttacatatttgcttgctcaatctgatgaagaggtatatgaatggttgaaaactgatccg
agcttgtctgacggcagggcagtctataccccatatcaagacaacgaagcaaacggtaaa
acatatgcaatttataatcagagctttgatattgttggtcatgaaaaatataaagatcga
atgattcgattaaaaggtgagttgaatgatgaagttgaactaaccgatctttattacgga
atgaccttagtcgggtggagtatggtgaaatcggatattccatcggaacaaattgaattg
ttaaaagatactggcatcagtattgagtctgcataa

DBGET integrated database retrieval system