KEGG   Bacillus subtilis subsp. subtilis 168: BSU20480Help
Entry
BSU20480          CDS       T00010                                 

Gene name
yoqX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIAV_Rev
Motif
Other DBs
NCBI-GeneID: 939597
NCBI-ProteinID: NP_389930
Pasteur: BG13682
BSORF: BG13682
UniProt: O31915
Position
complement(2191334..2191555)
Genome map
AA seq 73 aa AA seqDB search
MPQQTVEVKEVDVLIRGIWRKKKFTDIQKGQTFKIEENGRTKKYIARTDPYWDDMFETYI
IDLLDKNKIRRNK
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagcaaacagttgaggttaaagaagttgatgtgttgattaggggaatatggaga
aagaaaaagttcaccgatattcaaaaggggcaaacctttaagattgaggagaacggaaga
acaaagaaatacatagcgagaacagatccttattgggatgacatgtttgaaacttacatt
attgatttgttggataaaaataaaattagaagaaataagtaa

DBGET integrated database retrieval system