KEGG   Bacillus subtilis subsp. subtilis 168: BSU20490Help
Entry
BSU20490          CDS       T00010                                 

Gene name
yoqW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRAP
Motif
Other DBs
NCBI-GeneID: 939979
NCBI-ProteinID: NP_389931
Pasteur: BG13681
BSORF: BG13681
UniProt: O31916
Position
2191626..2192300
Genome map
AA seq 224 aa AA seqDB search
MCGRFTLFSEFDDIIEQFNIDQFLPEGEYHPSYNVAPSQNILTIINDGSNNRLGKLRWGL
IPPWAKDEKIGYKMINARAETLSEKPSFRKPLVSKRCIIPADSFYEWKRLDPKTKIPMRI
KLKSSNLFAFAGLYEKWNTPEGNPLYTCTIITTKPNELMEDIHDRMPVILTDENEKEWLN
PKNTDPDYLQSLLQPYDADDMEAYQVSSLVNSPKNNSPELIESH
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcaggttcactttattttctgagtttgatgacatcattgagcaattcaatata
gatcaattcttacctgaaggtgaatatcaccctagctataatgtcgctccttcacaaaac
atcctgacaatcatcaacgatggatccaataaccgtctgggcaaacttagatggggtctt
atccctccatgggctaaagacgaaaagatcggctataaaatgattaatgcccgtgctgaa
acattgtccgagaaacccagctttcgaaagccgctcgtaagcaaacgttgtatcataccg
gctgacagtttttatgaatggaaacgccttgatccaaagactaagattcctatgcggatt
aaacttaaatcgtccaatctcttcgcttttgcaggcttatacgaaaagtggaacacacca
gaaggcaatcctttatacacttgcacaatcattacaacaaagcctaatgagcttatggaa
gacatccatgatcggatgccggttatccttactgatgagaacgaaaaggaatggctcaac
cctaaaaatactgatcctgattatctacaaagcttactgcagccatatgatgctgatgac
atggaagcataccaggtttcatctttagtgaattcacctaaaaacaattcacctgagctc
attgaatcccattaa

DBGET integrated database retrieval system