KEGG   Bacillus subtilis subsp. subtilis 168: BSU20490
Entry
BSU20490          CDS       T00010                                 

Gene name
yoqW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SRAP
Other DBs
NCBI-GeneID: 939979
NCBI-ProteinID: NP_389931
Pasteur: BG13681
BSORF: BG13681
UniProt: O31916 A0A6M4JJQ5
Position
2191626..2192300
AA seq 224 aa
MCGRFTLFSEFDDIIEQFNIDQFLPEGEYHPSYNVAPSQNILTIINDGSNNRLGKLRWGL
IPPWAKDEKIGYKMINARAETLSEKPSFRKPLVSKRCIIPADSFYEWKRLDPKTKIPMRI
KLKSSNLFAFAGLYEKWNTPEGNPLYTCTIITTKPNELMEDIHDRMPVILTDENEKEWLN
PKNTDPDYLQSLLQPYDADDMEAYQVSSLVNSPKNNSPELIESH
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtgtggcaggttcactttattttctgagtttgatgacatcattgagcaattcaatata
gatcaattcttacctgaaggtgaatatcaccctagctataatgtcgctccttcacaaaac
atcctgacaatcatcaacgatggatccaataaccgtctgggcaaacttagatggggtctt
atccctccatgggctaaagacgaaaagatcggctataaaatgattaatgcccgtgctgaa
acattgtccgagaaacccagctttcgaaagccgctcgtaagcaaacgttgtatcataccg
gctgacagtttttatgaatggaaacgccttgatccaaagactaagattcctatgcggatt
aaacttaaatcgtccaatctcttcgcttttgcaggcttatacgaaaagtggaacacacca
gaaggcaatcctttatacacttgcacaatcattacaacaaagcctaatgagcttatggaa
gacatccatgatcggatgccggttatccttactgatgagaacgaaaaggaatggctcaac
cctaaaaatactgatcctgattatctacaaagcttactgcagccatatgatgctgatgac
atggaagcataccaggtttcatctttagtgaattcacctaaaaacaattcacctgagctc
attgaatcccattaa

DBGET integrated database retrieval system