KEGG   Bacillus subtilis subsp. subtilis 168: BSU20510Help
Entry
BSU20510          CDS       T00010                                 

Gene name
yoqU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 940143
NCBI-ProteinID: NP_389933
Pasteur: BG13679
BSORF: BG13679
UniProt: O31918
Position
complement(2193248..2193661)
Genome map
AA seq 137 aa AA seqDB search
MPNQEQIKRMNDINDLIKLIASIDHRTFYRKSKDRIAYFRFKKKLFFVDDYTGDDVYPYE
MGYGSPNGFSHGGNMWQLVNSFRKFIITGKCGELRDYKEIWAYSYEGCMKIRQKAKEIGF
IETVDYPYSFDEWMNTN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaatcaagagcaaataaaacgcatgaacgatattaatgatctgataaagcttatt
gcaagcattgatcatcgtacattctaccgcaagtcaaaggatcgtatagcgtatttcagg
tttaagaaaaaactgttcttcgttgatgattacacgggtgatgacgtttatccgtatgaa
atgggatacgggagtccaaacggcttttcgcatggaggcaacatgtggcaactggtcaac
agttttagaaagttcatcataacagggaaatgcggcgagctgagggattataaagaaata
tgggcttacagctatgaaggatgtatgaaaatccgtcagaaggcaaaagaaatagggttt
atagagactgttgattatccttatagcttcgatgaatggatgaatactaattga

DBGET integrated database retrieval system