KEGG   Bacillus subtilis subsp. subtilis 168: BSU20520Help
Entry
BSU20520          CDS       T00010                                 

Gene name
yoqT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939616
NCBI-ProteinID: NP_389934
Pasteur: BG13678
BSORF: BG13678
UniProt: O31919
Position
2193827..2193976
Genome map
AA seq 49 aa AA seqDB search
MELILDCFVNWSFDKIMDYILIAGLYFVFKSKSKQNYPDHFEEKRRHRN
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atggaattaatcttagattgtttcgtgaattggtcatttgacaaaatcatggactacatc
ttaattgcaggactttattttgtgttcaaatcgaaatctaaacagaattatcctgatcac
ttcgaagaaaaacgccggcatagaaattaa

DBGET integrated database retrieval system