KEGG   Bacillus subtilis subsp. subtilis 168: BSU20530
Entry
BSU20530          CDS       T00010                                 

Gene name
yoqS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939995
NCBI-ProteinID: NP_389935
Pasteur: BG13677
BSORF: BG13677
UniProt: O31920 A0A6M4JLG3
Position
complement(2194053..2194400)
AA seq 115 aa
MYRKIFDMVNGSEEQSKITDWLYKLMIEDENSLYKIDIKVSKRRISEQGDIYREEGEYIE
NADLQTLPIGTKSFVQNGCWKGEIVSNEKKHLYMPQIGEMREIKVGSTGLNIEIE
NT seq 348 nt   +upstreamnt  +downstreamnt
atgtacaggaagattttcgatatggttaacggtagtgaagagcaatcaaaaataactgat
tggctatataaattaatgattgaggatgaaaattcactttacaaaatcgacattaaagtt
tcgaaaaggaggatttctgaacaaggagatatttatagagaggagggagaatacatagag
aacgcagatcttcaaactttaccaatcgggacaaaatcctttgtgcaaaacggttgttgg
aagggtgaaattgtttctaatgaaaagaaacatttatatatgccacagattggagagatg
agggaaatcaaagttggatcaactgggttgaatatagagattgaataa

DBGET integrated database retrieval system