KEGG   Bacillus subtilis subsp. subtilis 168: BSU20540
Entry
BSU20540          CDS       T00010                                 

Gene name
yoqR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939440
NCBI-ProteinID: NP_389936
Pasteur: BG13676
BSORF: BG13676
UniProt: O31921 A0A6M4JI55
Position
complement(2194402..2194758)
AA seq 118 aa
MKKRNQYSITVDVNGGEYNQEFVILADSLSKVGRDKIIADGVTIQFNDQILELNSNKEDS
NDYYKGQTLTVKEDCLNNFWKGGTVTVEDVDIHRGILIDGVVYLEKQVVDKYFSKEEE
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaaaaaaagaaatcaatactcaattacagtggatgttaatggaggagaatataatcag
gagtttgttattttagcggattcgctaagtaaagttgggcgagataagataattgctgat
ggtgtgacaattcaatttaatgaccagattcttgaattgaatagtaataaagaagattcg
aatgattattataagggtcaaacattaactgttaaagaagattgcctaaataacttctgg
aaaggcggaaccgttactgttgaagatgtagatatacatagaggcatattgatagacggt
gtcgtttacttagaaaaacaagtggtagacaagtatttttcaaaagaagaggaatga

DBGET integrated database retrieval system