KEGG   Bacillus subtilis subsp. subtilis 168: BSU20550
Entry
BSU20550          CDS       T00010                                 

Gene name
yoqP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Plk4_PB2
Other DBs
NCBI-GeneID: 939583
NCBI-ProteinID: NP_389937
Pasteur: BG13675
BSORF: BG13675
UniProt: O31922 A0A6M3ZI21
Position
complement(2194718..2195059)
AA seq 113 aa
MNTYVVDDSKYKCIYAGTEKAAAFNNEFENGTRVRVWFEGHHIKTFEKEQREVCGVGEWI
VKYDAATELQKEVNRLEKTYFKKKELLDTIRQADGVGREINEKKKSILNYSGC
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaacacttatgtagtcgatgacagcaagtataaatgtatttatgcgggaactgagaaa
gcagctgcttttaataatgaatttgaaaacggaacaagagtaagggtttggtttgaaggc
catcacataaaaacgtttgagaaagaacaaagagaagtctgtggagtaggagaatggatc
gttaagtatgatgctgctactgaattgcaaaaggaagtaaatcgtttggaaaagacctat
ttcaagaagaaagagttgttagacactattagacaagctgatggggtcggaagggaaatc
aatgaaaaaaagaaatcaatactcaattacagtggatgttaa

DBGET integrated database retrieval system