KEGG   Bacillus subtilis subsp. subtilis 168: BSU20560Help
Entry
BSU20560          CDS       T00010                                 

Gene name
yoqO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YoqO DUF202
Motif
Other DBs
NCBI-GeneID: 936492
NCBI-ProteinID: NP_389938
Pasteur: BG13674
BSORF: BG13674
UniProt: O31923
Position
2195173..2195547
Genome map
AA seq 124 aa AA seqDB search
MSKTIGITGFFLSIVVQSFSANDSLSHKIATGLLFVSIAIYNFDHAKDYSKASLVVICLT
FFVLALGIHKLLSFSSDLFDNVNINFGVIFILQITLIIGSVAIAISIMKFICDRLKKKPN
GKEC
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaaacaatcggtattactggatttttcttaagcatagtagtgcaatcattttcg
gcgaatgattcgctatcccacaagatcgctacgggtttattatttgtatcaatagcaatt
tataattttgaccacgctaaagattattccaaagcatcccttgtcgtaatatgcctcacc
tttttcgtacttgccttgggtattcataagcttctttccttttcgagtgacttatttgac
aatgtgaatataaatttcggagtaatattcatcctccaaatcacattaataattggatct
gttgcaatagctatcagtataatgaaatttatctgtgatcgtctaaaaaagaaacctaac
ggtaaagagtgttaa

DBGET integrated database retrieval system