KEGG   Bacillus subtilis subsp. subtilis 168: BSU20570Help
Entry
BSU20570          CDS       T00010                                 

Gene name
yoqN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NapD
Motif
Other DBs
NCBI-GeneID: 936507
NCBI-ProteinID: NP_389939
Pasteur: BG13673
BSORF: BG13673
UniProt: O31924
Position
complement(2195564..2195782)
Genome map
AA seq 72 aa AA seqDB search
MVIKRNLLSNHVDEIIGEYYAAKGYSVHSIDRQENGQLIVVTERVAEEKENAKVDIAFDF
VHRRPHKKKYLA
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
ttggtgataaagaggaatctgcttagcaaccacgttgatgagattatcggagaatattac
gctgctaaaggatattcagtccatagcattgaccgccaggaaaatggacaactaatcgtt
gttacggagcgagtagcagaggagaaggaaaatgcaaaagttgatatagcatttgatttt
gtacatagaagaccacataagaagaagtatttagcataa

DBGET integrated database retrieval system