KEGG   Bacillus subtilis subsp. subtilis 168: BSU20580Help
Entry
BSU20580          CDS       T00010                                 

Gene name
yoqM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: lci
Motif
Other DBs
NCBI-GeneID: 939973
NCBI-ProteinID: NP_389940
Pasteur: BG13672
BSORF: BG13672
UniProt: O31925
Position
2195986..2196264
Genome map
AA seq 92 aa AA seqDB search
MKLRKVLTGSVLSLGLLVSASPAFATSPSAMVKENNIVQDEISVKELHTKYIYHHNINDF
KNIEKDENGRNWYLKGIEYKDGWYVGKYQANY
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagaaaagtattgactggttctgttttatctcttggattactcgtttctgct
tctcctgcattcgctactagcccatctgctatggttaaagagaataacattgttcaagac
gaaataagtgtgaaagaattgcatacaaagtatatttaccatcacaatattaatgatttt
aaaaatattgagaaagacgaaaacggtagaaactggtacttaaaaggcattgaatataaa
gatggatggtatgtagggaagtaccaagcaaattattga

DBGET integrated database retrieval system