KEGG   Bacillus subtilis subsp. subtilis 168: BSU20590Help
Entry
BSU20590          CDS       T00010                                 

Gene name
yoqL
Definition
(RefSeq) HNH endonuclease YoqL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH HNH_5 TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 939974
NCBI-ProteinID: NP_389941
Pasteur: BG13671
BSORF: BG13671
UniProt: O34581
Position
complement(2196389..2197081)
Genome map
AA seq 230 aa AA seqDB search
MDSKKHKIINGYYHKNCISCKSWLPATEENFYSVKKNKDGLHSYCKACVLKKAKESMLKN
YDKQLERMRERNLLPGMKEAKKKYNSSLKKKKTQQIWQEKNKLKLKNYRLQRDAHKKHNI
TDVQWQKCKDYFNNKCSYCGLKIEDHKILFKGTYIQSDFHKEHVDHKGANDISNCIPACK
SCNSSKHDFAFEEWYNSSNKNFSSERLLKIKEWLNRFKEERQDSEWRTKG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
attgatagtaaaaagcataaaataataaacggatattatcacaagaattgtataagttgt
aaaagctggttaccggcaactgaagagaatttttactctgtgaagaaaaataaggatgga
cttcattcatactgtaaagcttgtgtattaaaaaaggctaaagaaagcatgttgaagaat
tatgacaaacagcttgaacgaatgagggaaagaaatcttcttccagggatgaaagaggcc
aaaaagaaatacaactcaagtttgaaaaagaaaaaaacacaacaaatctggcaagaaaag
aacaagctaaaattaaaaaactaccgtttacaaagagatgctcacaagaaacataacatt
acagatgtacagtggcaaaagtgcaaagactattttaacaacaagtgttcctattgcggg
ctgaaaattgaagatcataagatattattcaaaggaacctatatacaaagtgattttcat
aaagagcatgtagatcacaaaggggctaatgatataagcaactgcatacctgcttgtaaa
tcttgcaatagctcaaagcacgactttgcatttgaagagtggtacaactcatcaaacaaa
aacttttcatccgaaagattactaaagatcaaagagtggctaaatcgttttaaagaggaa
cgacaagattcagaatggaggacaaaaggatag

DBGET integrated database retrieval system