KEGG   Bacillus subtilis subsp. subtilis 168: BSU20610Help
Entry
BSU20610          CDS       T00010                                 

Gene name
yoqJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YpsA DNA_processg_A
Motif
Other DBs
NCBI-GeneID: 939585
NCBI-ProteinID: NP_389943
Pasteur: BG13669
BSORF: BG13669
UniProt: O34359
Position
complement(2197344..2197859)
Genome map
AA seq 171 aa AA seqDB search
MKNPTMLKLKDKLLAVIEELITKENKYRFITGGALGTDQAACWCVHILKKKHPHIKNIIA
TPFKEQDKVWSADQKMWYKRMLNVADEIINVEELDKYKVSGEKPGEFSPAKMQKRNEYMI
DHSEAIVAVYDGSKSGTRNCLNYAKKTYLGHQLWRLHPDFNFELDITYFVG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccaacaatgcttaaactcaaagataagctgcttgcagtaattgaagaatta
atcactaaggaaaacaagtataggtttataactggaggagcgttaggaactgatcaggct
gcttgttggtgtgtgcatattctaaagaagaaacaccctcatatcaaaaacataattgcc
acacctttcaaagaacaagataaagtttggtctgcagaccaaaaaatgtggtacaaacgt
atgcttaatgtagcagatgagattattaatgttgaagaattagataaatataaagttagt
ggagagaaaccaggagagttttcgccagctaagatgcaaaagcgaaatgaatacatgatt
gatcacagtgaggcaatagtagctgtttatgatggaagtaaaagtggtacaagaaactgc
ttaaattacgccaagaaaacttacttaggacatcagctatggagacttcatcctgatttt
aattttgaattagatattacgtattttgttggatga

DBGET integrated database retrieval system