KEGG   Bacillus subtilis subsp. subtilis 168: BSU20620Help
Entry
BSU20620          CDS       T00010                                 

Gene name
yoqI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939965
NCBI-ProteinID: NP_389944
Pasteur: BG13668
BSORF: BG13668
UniProt: O34339
Position
complement(2198070..2198264)
Genome map
AA seq 64 aa AA seqDB search
MIKSIILPEENTKITVGKPINDESNTKVIAIYDYREEPEEAFWVHLSNGNDLFVDNHEVI
VEYE
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatcgattattttacctgaagaaaacacaaaaataactgtaggtaaaccgata
aatgatgaatcaaatacaaaggtaattgctatttatgactatagagaagaaccagaagaa
gctttctgggtacacttatcaaatgggaatgatctatttgtagataaccatgaagtcatt
gttgagtatgaatag

DBGET integrated database retrieval system