KEGG   Bacillus subtilis subsp. subtilis 168: BSU20630Help
Entry
BSU20630          CDS       T00010                                 

Gene name
yoqH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939438
NCBI-ProteinID: NP_389945
Pasteur: BG13667
BSORF: BG13667
UniProt: O34999
Position
complement(2198313..2198765)
Genome map
AA seq 150 aa AA seqDB search
MKRFILVLSFLSIIVAYPIQTNASPMPCSVILEPVDKNLKNAKGVALIYKVQLNPPSAAR
TNISILAVHLPAPSSFGNYDSYEGFATKPGEISWRFKLYPTPEEESPSWAGRIDTISAEM
KNVKVQVRLSNSSTQKLGPSILTKNIESCY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatttattttagttttatcctttttaagtattattgttgcctatcccattcaa
acaaacgccagtccaatgccttgcagtgtaatactggagccggtagataaaaatcttaaa
aatgctaaaggtgtagcattaatctataaggtgcaattgaacccaccgagtgctgccaga
accaatataagtattcttgctgtccatcttcctgcaccttcttcttttggaaattacgac
agttacgaaggatttgctactaaaccaggtgagattagttggcggtttaaactttatcct
actcctgaggaagagagtcctagttgggcgggaagaattgacacaatttcggccgaaatg
aagaatgttaaagtgcaagtgcgtctgtcaaattctagcacacaaaagttggggccaagt
atattaacgaaaaatattgagtcctgttattga

DBGET integrated database retrieval system