KEGG   Bacillus subtilis subsp. subtilis 168: BSU20640Help
Entry
BSU20640          CDS       T00010                                 

Gene name
yoqG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936494
NCBI-ProteinID: NP_389946
Pasteur: BG13666
BSORF: BG13666
UniProt: O35030
Position
complement(2198848..2199105)
Genome map
AA seq 85 aa AA seqDB search
MEKMNLLKEITIFDLNKIKPGTKVQVTWYKGTEMEYTHNGEVIINNGEKFYYNYVDKEGY
VGHCHVNALDLKNYPDSLIVEIKSK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatgaacctgctaaaagaaataacaatatttgatttaaataaaatcaaacct
ggcacaaaagttcaagtaacttggtataaaggaacagagatggagtatacacataatggc
gaagttatcattaataatggggaaaagttttattataattacgttgataaagaaggatat
gtaggtcactgtcatgtaaacgcacttgatttgaaaaactatcctgacagtctaattgtt
gagattaaatcaaaataa

DBGET integrated database retrieval system