KEGG   Bacillus subtilis subsp. subtilis 168: BSU20650
Entry
BSU20650          CDS       T00010                                 

Gene name
yoqF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936493
NCBI-ProteinID: NP_389947
Pasteur: BG13665
BSORF: BG13665
UniProt: O34584 A0A6M3ZCQ2
Position
complement(2199150..2199353)
AA seq 67 aa
MKFAPMDKVKFKTASHLNKLRTLKKRVPELDDPLLGECWEFEEDGLRQFDWEENYEFVAR
PKHFNWD
NT seq 204 nt   +upstreamnt  +downstreamnt
atgaaatttgcaccaatggataaagttaaatttaaaacagctagtcatctcaacaaactt
cgaactttaaaaaaaagagttcctgaattagacgatcctttactcggcgaatgctgggaa
tttgaagaagatggtttgagacaatttgattgggaggagaactacgaatttgtcgctaga
cccaaacattttaattgggattaa

DBGET integrated database retrieval system