KEGG   Bacillus subtilis subsp. subtilis 168: BSU20660Help
Entry
BSU20660          CDS       T00010                                 

Gene name
yoqE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939433
NCBI-ProteinID: NP_389948
Pasteur: BG13664
BSORF: BG13664
UniProt: O34429
Position
complement(2199362..2199526)
Genome map
AA seq 54 aa AA seqDB search
MENNVLYGVYSTRSRKFCFGIEEPSKTKARKELFNRIGTDAYKWRFEIRKIKRK
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atggagaataatgttttatacggagtttacagtactagatcacgaaagttttgctttgga
attgaggagccttcaaaaacaaaagcaagaaaagagctattcaatcgaattggtacagat
gcatacaaatggcgttttgaaataagaaaaattaaaagaaagtag

DBGET integrated database retrieval system