KEGG   Bacillus subtilis subsp. subtilis 168: BSU20660
Entry
BSU20660          CDS       T00010                                 

Gene name
yoqE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939433
NCBI-ProteinID: NP_389948
Pasteur: BG13664
BSORF: BG13664
UniProt: O34429 A0A6M4JI64
Position
complement(2199362..2199526)
AA seq 54 aa
MENNVLYGVYSTRSRKFCFGIEEPSKTKARKELFNRIGTDAYKWRFEIRKIKRK
NT seq 165 nt   +upstreamnt  +downstreamnt
atggagaataatgttttatacggagtttacagtactagatcacgaaagttttgctttgga
attgaggagccttcaaaaacaaaagcaagaaaagagctattcaatcgaattggtacagat
gcatacaaatggcgttttgaaataagaaaaattaaaagaaagtag

DBGET integrated database retrieval system