KEGG   Bacillus subtilis subsp. subtilis 168: BSU20670Help
Entry
BSU20670          CDS       T00010                                 

Gene name
yoqD
Definition
(RefSeq) antirepressor protein YoqD
  KO
K07741  anti-repressor protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU20670 (yoqD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANT Phage_pRha Methyltransf_18
Motif
Other DBs
NCBI-GeneID: 939436
NCBI-ProteinID: NP_389949
Pasteur: BG13663
BSORF: BG13663
UniProt: O34449
Position
complement(2199580..2200335)
Genome map
AA seq 251 aa AA seqDB search
MESYLTVIEQNGQLLVDSREVAEMVGKRHTDLLRSIDGYVAILLNAKLRSVEFFLESTYK
DATGRSLKHFHLTRKGCDMVANKMTGAKGVLFTAQYVSKFEEMEKALKARPSLIDTYLDM
NEDERAIAYFTERKAKRELQEQLTLAEPKVEKYDRFLNTDGLMKIGQVAKAIGIKGMGQN
NLFRFLRENKVLIDGTNKNAPYQKYVERGFFQVKTQETSVGIKTITLVTPKGADFIVDLL
KKHGHKREIAS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaaagttatctaacagtaattgaacagaatggacagcttttggttgacagccgtgaa
gtggcagagatggtaggtaagagacatacagatttacttagaagtattgatggatatgta
gcgatcttactaaacgcaaaattgcgttcagtggaatttttcttagaaagtacatataaa
gatgcaactggtcgctcattgaagcatttccatttaacccgaaaaggatgcgatatggtt
gctaataaaatgactggtgctaaaggggtattattcacagctcaatatgtttctaaattt
gaagaaatggagaaggcgttaaaagcaagaccgtccctaattgatacatatctagatatg
aatgaagatgaacgtgccattgcttatttcactgaaagaaaagcaaaacgagaattgcag
gagcaattaacattggctgaaccaaaagtggagaaatatgatcgctttcttaatacagat
ggattaatgaaaataggacaagtggcaaaagcaattggcataaaaggaatgggccaaaac
aatttatttcgctttttgagggaaaataaagttcttattgatggaacaaacaaaaacgcc
ccatatcaaaaatatgtagaaagaggattctttcaagtgaagacccaggagacaagtgtt
ggaattaaaacaattactcttgttactcctaaaggtgccgattttattgttgatcttcta
aagaaacatgggcacaaaagagaaatagcatcatag

DBGET integrated database retrieval system