KEGG   Bacillus subtilis subsp. subtilis 168: BSU20680Help
Entry
BSU20680          CDS       T00010                                 

Gene name
yoqC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Choline_sulf_C
Motif
Other DBs
NCBI-GeneID: 936489
NCBI-ProteinID: NP_389950
Pasteur: BG13662
BSORF: BG13662
UniProt: O34834
Position
complement(2200376..2200783)
Genome map
AA seq 135 aa AA seqDB search
MEVNVKTNQREKFIRNGIPYDELDTQMIHLIDILNFKIGLKTRHCCFGHKPYEEIQVMFE
DEVNIKEDQILELAELAGREWKGLQLSFSKWARFSPLMFNWSLVLSKRFRNPEDPNKYRY
LRSVEEFFESYAAKK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
ttggaggttaatgtgaaaacaaaccaaagagaaaaattcatccgaaatggtatcccatat
gatgaacttgatacacaaatgattcatttaattgatattttaaatttcaaaattggatta
aaaacacgccactgttgttttgggcataaaccatacgaagaaattcaagtgatgtttgaa
gacgaagtgaacataaaagaagatcagattctagaattagcagaactagcgggtagggaa
tggaaaggcctacagttaagctttagcaaatgggcaagattttccccattgatgtttaat
tggtcattggtgttatcgaagagattcagaaacccagaagatccaaataaataccgttat
ctaagatcagttgaagaattctttgagagctatgctgcaaagaagtga

DBGET integrated database retrieval system