KEGG   Bacillus subtilis subsp. subtilis 168: BSU20690
Entry
BSU20690          CDS       T00010                                 

Gene name
yoqB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939431
NCBI-ProteinID: NP_389951
Pasteur: BG13661
BSORF: BG13661
UniProt: O34831 A0A6M4JI29
Position
complement(2200790..2201128)
AA seq 112 aa
MKEFHLHKYPVTSVEGNEYAVSIYNDRHSKGFVKVSLYKKVRGFFRKEKFKCLTREGDFA
PSYFEEKWDYDYIQMAINEVINYENSIKEQINHENKQKAAIEKFEAWSGQEV
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaaggaatttcatttgcacaaatatcccgtgacatcagttgaagggaatgagtatgcc
gttagcatttataacgatagacactcaaaaggttttgtcaaagtatctttatataaaaag
gtgcgcggttttttcaggaaagaaaaattcaagtgtcttacaagagaaggagacttcgct
ccgagttatttcgaagaaaagtgggattacgattacatacagatggcaatcaatgaagtt
attaactatgaaaactccataaaggagcaaattaatcatgaaaataaacaaaaggctgca
atagaaaaatttgaagcgtggagtggccaggaggtgtaa

DBGET integrated database retrieval system