KEGG   Bacillus subtilis subsp. subtilis 168: BSU20700Help
Entry
BSU20700          CDS       T00010                                 

Gene name
yoqA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939434
NCBI-ProteinID: NP_389952
Pasteur: BG13660
BSORF: BG13660
UniProt: O34988
Position
complement(2201125..2201475)
Genome map
AA seq 116 aa AA seqDB search
MMEEIDNNELKFRMITPDGESFLVNSAPIEGWQNDIWKTFDEQKRVFDAEIKKAFEHCNV
PLEETIERAELVVDKDDNTVLTIDKLPVLILYKPEFLYSKGKAVQRYKRLYEEDVE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgatggaggaaatagataacaacgaattgaagttccgaatgattacgccggatggagaa
tcatttctggttaattctgcacctattgaaggctggcaaaatgatatttggaagacgttt
gatgaacagaaacgggttttcgatgcagagattaaaaaagcatttgaacactgtaacgta
ccgttggaggaaacaattgaacgggctgaattagtcgtagataaggacgacaacactgtt
ctgaccatagacaaactaccggttttaatcttatataaacctgaatttttatattcgaaa
ggaaaagcagttcaaagatacaaacgactttatgaggaggacgtggaatga

DBGET integrated database retrieval system