KEGG   Bacillus subtilis subsp. subtilis 168: BSU20710Help
Entry
BSU20710          CDS       T00010                                 

Gene name
yopZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bZIP_1 CENP-H DivIC FlaC_arch TolA_bind_tri CCDC14
Motif
Other DBs
NCBI-GeneID: 936487
NCBI-ProteinID: NP_389953
Pasteur: BG13659
BSORF: BG13659
UniProt: O34509
Position
complement(2201488..2201691)
Genome map
AA seq 67 aa AA seqDB search
MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS
AIKYLWG
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagtgaaatgcaattacaggcacagatcgacgttatcgaaaaagaaaataaggaa
ttgcgtcgcaggaatgaggaattagggcagacggtcgaatgtcagaacaaacagatcgtc
actcaaaattggagactgttgtttttcgcttcatcctggatcgtttatggaattgttagt
gctataaaatacctttggggataa

DBGET integrated database retrieval system