KEGG   Bacillus subtilis subsp. subtilis 168: BSU20710
Entry
BSU20710          CDS       T00010                                 

Gene name
yopZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bZIP_1 DivIC DUF5660 CENP-H FlaC_arch TolA_bind_tri CCDC14
Other DBs
NCBI-GeneID: 936487
NCBI-ProteinID: NP_389953
Pasteur: BG13659
BSORF: BG13659
UniProt: O34509 A0A6M3ZCY2
Position
complement(2201488..2201691)
AA seq 67 aa
MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS
AIKYLWG
NT seq 204 nt   +upstreamnt  +downstreamnt
gtgacaagtgaaatgcaattacaggcacagatcgacgttatcgaaaaagaaaataaggaa
ttgcgtcgcaggaatgaggaattagggcagacggtcgaatgtcagaacaaacagatcgtc
actcaaaattggagactgttgtttttcgcttcatcctggatcgtttatggaattgttagt
gctataaaatacctttggggataa

DBGET integrated database retrieval system