KEGG   Bacillus subtilis subsp. subtilis 168: BSU20720Help
Entry
BSU20720          CDS       T00010                                 

Gene name
yopY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936488
NCBI-ProteinID: NP_389954
Pasteur: BG13658
BSORF: BG13658
UniProt: O34730
Position
complement(2201705..2201983)
Genome map
AA seq 92 aa AA seqDB search
MTINLKVKQEKRKGLSINDIQDGYFILRNDDVWIVKMDVTNRNKIHLIDLETFHVKTVST
KNDLKSLFEDWSRIKILSPKQVNLNIGFQWKE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaatttgaaagtaaaacaagagaagcgcaaagggttatcaattaatgatatc
caagatggatacttcattttaagaaatgacgatgtttggattgtgaaaatggatgttaca
aatagaaataagatacatttaatcgatttagagacgttccatgttaaaactgtatcaaca
aagaacgatttgaaaagtttgtttgaagattggagccgaattaagatattaagtccgaaa
caggtgaatttaaatatcgggttccaatggaaagagtaa

DBGET integrated database retrieval system