KEGG   Bacillus subtilis subsp. subtilis 168: BSU20730Help
Entry
BSU20730          CDS       T00010                                 

Gene name
yopX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YopX
Motif
Other DBs
NCBI-GeneID: 939430
NCBI-ProteinID: NP_389955
Pasteur: BG13657
BSORF: BG13657
UniProt: O34401
Structure
PDB: 

Position
complement(2201980..2202384)
Genome map
AA seq 134 aa AA seqDB search
MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKV
RGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKISADYDVTAVGWVEYATIEVI
GDVYQNPELLEGVK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcatacagagtttgggacggcgagcagatgcattattgggatgatgaaggt
ttgagccttatcatcaaaagcaacggcgattggactttgaaacgtttatacacagatgtt
ttggttccggttgtagacagcacgaatagaaacgcggctctcatgtggggagcaaaggta
agaggcaaatttatttatgataggtctatagtaaaaataacgagtgatgataaagaatca
tcagatgtttgcgaagttaagttttcagatggcgttttccaagtagatgtatcaaaaatt
tccgctgattatgacgtgactgccgtcgggtgggtggaatatgcaactattgaagtaatc
ggagacgtttatcaaaatcctgagttattggagggtgtgaaatga

DBGET integrated database retrieval system