KEGG   Bacillus subtilis subsp. subtilis 168: BSU20740
Entry
BSU20740          CDS       T00010                                 

Gene name
yopW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936484
NCBI-ProteinID: NP_389956
Pasteur: BG13656
BSORF: BG13656
UniProt: O34838 A0A6M4JJN4
Position
complement(2202381..2202716)
AA seq 111 aa
MELSLDELKLCLKPLVFFGELKLEISDYEEGKKIEVLDHDEGSLINLADQTINENYVCTT
CNCTLYTNENNEVCFIEHPYGAITAVNKDQVIHLTKLIGAIINTDEEDPVE
NT seq 336 nt   +upstreamnt  +downstreamnt
ttggaattatcattagatgaattgaagctctgtcttaaaccattagtgtttttcggtgag
ttaaaacttgaaatcagtgattatgaagaaggtaagaaaattgaagtgctggatcatgat
gaagggtctttaattaatttagcagaccaaacgattaacgaaaattatgtgtgtactaca
tgtaattgtactttatataccaatgaaaataatgaagtatgtttcatagagcatccgtat
ggtgcaatcacagctgtaaataaagatcaagtgattcatttaactaagctaattggagca
atcataaatacggatgaggaggatccagttgaatga

DBGET integrated database retrieval system