KEGG   Bacillus subtilis subsp. subtilis 168: BSU20750
Entry
BSU20750          CDS       T00010                                 

Gene name
yopV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SAD_SRA
Other DBs
NCBI-GeneID: 939432
NCBI-ProteinID: NP_389957
Pasteur: BG13655
BSORF: BG13655
UniProt: O34869 A0A6M3ZCR2
Position
complement(2202805..2202999)
AA seq 64 aa
MLLDEKLDKLMKTILRLKAYKEEENLRRVIGEFHSIIDYAYEGMYIAEDMLREEESKGKE
VSTY
NT seq 195 nt   +upstreamnt  +downstreamnt
atgttgcttgatgaaaagctcgataaattaatgaaaacgattctgcgattaaaagcatac
aaagaagaggaaaatttacgaagagtcatcggagaatttcattcaataattgattatgct
tacgaggggatgtatatagctgaagatatgttaagagaagaagaaagtaagggcaaagaa
gtaagtacatattga

DBGET integrated database retrieval system