KEGG   Bacillus subtilis subsp. subtilis 168: BSU20750Help
Entry
BSU20750          CDS       T00010                                 

Gene name
yopV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAD_SRA
Motif
Other DBs
NCBI-GeneID: 939432
NCBI-ProteinID: NP_389957
Pasteur: BG13655
BSORF: BG13655
UniProt: O34869
Position
complement(2202805..2202999)
Genome map
AA seq 64 aa AA seqDB search
MLLDEKLDKLMKTILRLKAYKEEENLRRVIGEFHSIIDYAYEGMYIAEDMLREEESKGKE
VSTY
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttgatgaaaagctcgataaattaatgaaaacgattctgcgattaaaagcatac
aaagaagaggaaaatttacgaagagtcatcggagaatttcattcaataattgattatgct
tacgaggggatgtatatagctgaagatatgttaagagaagaagaaagtaagggcaaagaa
gtaagtacatattga

DBGET integrated database retrieval system