KEGG   Bacillus subtilis subsp. subtilis 168: BSU20760Help
Entry
BSU20760          CDS       T00010                                 

Gene name
yopU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936485
NCBI-ProteinID: NP_389958
Pasteur: BG13654
BSORF: BG13654
UniProt: O34937
Position
complement(2203111..2203308)
Genome map
AA seq 65 aa AA seqDB search
MNIFVDQDNYKEVSLKLTKKLLTSEHYQFLLCFKGEKLDITISVTPQSLVKLRDDINELI
FMFSD
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatatttgttgatcaagataattacaaagaggttagtctgaaacttacaaaaaaa
ttgctgacttcagaacattatcaattcctactttgtttcaagggagagaaattagatatt
acaatttcagttacaccacaaagcctcgttaagcttagggatgacatcaatgaattgatc
tttatgttctcagattaa

DBGET integrated database retrieval system