KEGG   Bacillus subtilis subsp. subtilis 168: BSU20770Help
Entry
BSU20770          CDS       T00010                                 

Gene name
yopT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Yopt
Motif
Other DBs
NCBI-GeneID: 939424
NCBI-ProteinID: NP_389959
Pasteur: BG13653
BSORF: BG13653
UniProt: O34498
Structure
PDB: 

Position
complement(2203378..2203596)
Genome map
AA seq 72 aa AA seqDB search
MAGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDM
EYEITNTEELPE
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggcaggttatttaaacaatattgcactgaatctggagattgtactcaaaaacaaagca
gatagtccagaagtctctgaaacattagtaaccaggatttgtgaaaatttacttttatct
aaagaagtctcgtttttaaaagctgacggatcagttgaaaattttaaattaagtgatatg
gaatatgaaataacaaatacagaagaattgcctgagtaa

DBGET integrated database retrieval system