KEGG   Bacillus subtilis subsp. subtilis 168: BSU20770
Entry
BSU20770          CDS       T00010                                 

Gene name
yopT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Yopt
Other DBs
NCBI-GeneID: 939424
NCBI-ProteinID: NP_389959
Pasteur: BG13653
BSORF: BG13653
UniProt: O34498 A0A6M3ZCV2
Structure
PDB: 
2DLB

Position
complement(2203378..2203596)
AA seq 72 aa
MAGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDM
EYEITNTEELPE
NT seq 219 nt   +upstreamnt  +downstreamnt
atggcaggttatttaaacaatattgcactgaatctggagattgtactcaaaaacaaagca
gatagtccagaagtctctgaaacattagtaaccaggatttgtgaaaatttacttttatct
aaagaagtctcgtttttaaaagctgacggatcagttgaaaattttaaattaagtgatatg
gaatatgaaataacaaatacagaagaattgcctgagtaa

DBGET integrated database retrieval system