KEGG   Bacillus subtilis subsp. subtilis 168: BSU20800Help
Entry
BSU20800          CDS       T00010                                 

Gene name
yopQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DndB PH_15
Motif
Other DBs
NCBI-GeneID: 936481
NCBI-ProteinID: NP_389962
Pasteur: BG13650
BSORF: BG13650
UniProt: O34448
Position
complement(2205193..2206575)
Genome map
AA seq 460 aa AA seqDB search
MTVIFDQSANEKLLSEMKDAISKNKHIRSFINDIQLEMAKNKITPGTTQKLIYDIENPEV
EISKEYMYFLAKSLYSVLESERFNPRNYFTETDMREIETLWEGSVEEDIKFPYTFKQVVK
YSDDNYFFPITAKELFMLFENKLLHYNPNAQRTNKTKKLEGSDIEIPVPQLNKQSVEEIK
ELFLDGKLIKSVFTFNARVGSASCGEELKYDDDTMSLTVTEDTILDVLDGYHRLIGITMA
IRQHPELDHLFEETFKVDIYNYTQKRAREHFGQQNTINPVKKSKVAEMSQNVYSNKIVKF
IQDNSIIGDYIKTNGDWINQNQNLLITFSDFKKAIERSYSKKDFSTQADILKTARYLTSF
FDALATQYVDEFLGDIAKERKRSFVNNYLFFNGYVGLAKKLQLDGVSLDELESKITDVLG
SIDFSKKNKLWDELGVVDKNGNAKSPQKIWNFFNNLKIDE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgatctttgatcagtctgcaaatgagaaactgctttcagaaatgaaagatgct
atctcgaaaaataaacacataagatcttttattaacgatattcaattagagatggctaaa
aataaaattactccagggacaacacaaaaattaatttatgatatagaaaatccagaagtc
gaaatttctaaagaatatatgtactttttagccaagtccctatactcagttcttgaaagt
gaaaggtttaatccacgaaattacttcacagaaacggatatgagagaaattgaaacgtta
tgggaaggatctgtggaggaagatataaaatttccgtatacattcaaacaagttgtaaag
tattcggatgataattatttcttccccatcactgctaaagagttgtttatgctatttgaa
aataagttattgcactataatcctaatgctcaaagaacgaacaaaacgaaaaaactagag
ggctcagatattgagatacctgtaccgcagctcaataaacaatcggttgaagaaataaag
gaactgttcttagatgggaaattaattaaatcagtttttacgtttaatgcacgtgttgga
agcgcaagttgtggcgaagaattaaaatatgatgacgacactatgtctcttacagtgact
gaagacaccattttagacgttttagacgggtatcaccggctaataggcattactatggct
ataagacaacatcctgagttagatcatttgtttgaagaaacctttaaagtggacatctat
aactacactcaaaaaagggcgagagagcattttgggcaacaaaacacaataaacccagtt
aaaaaatctaaagtggctgagatgagtcaaaatgtttattcaaataaaattgttaagttt
attcaggacaatagcataattggtgattatataaagacaaatggagactggataaatcag
aatcaaaacttacttataactttttctgacttcaaaaaggcaattgaaagaagctattct
aaaaaagatttttctactcaagcagacatcttaaaaactgcaagataccttacatctttc
tttgatgctttagctacacaatatgtagatgagttcttaggtgatatagcaaaagaacgg
aagagaagttttgtaaacaactatttgttctttaatggttatgtgggattagctaagaaa
ttgcaattagatggggtaagcctagacgagttggaaagtaagattactgatgttttaggc
tctatagattttagtaagaaaaataagttgtgggatgaattaggtgtagtagacaagaat
ggaaatgctaaatcaccacaaaagatatggaatttcttcaataatttaaaaatagacgag
taa

DBGET integrated database retrieval system