KEGG   Bacillus subtilis subsp. subtilis 168: BSU20810Help
Entry
BSU20810          CDS       T00010                                 

Gene name
yopP
Definition
(RefSeq) integrase/recombinase YopP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_4 Phage_int_SAM_1 CAAP1 Phage_int_SAM_5 Ribosomal_L38e
Motif
Other DBs
NCBI-GeneID: 936482
NCBI-ProteinID: NP_389963
Pasteur: BG13649
BSORF: BG13649
UniProt: O34336
Position
complement(2206682..2207758)
Genome map
AA seq 358 aa AA seqDB search
MQNKIKQLKNYAVYDDIEGFLINKDIRSSSGNSNYMMPSSTRRVSNTRKNYEGDIKQFFS
VIKGKDVKSLVPDDLVVSKSELSNYVKYLQEKGLVNNSINRKMTSLKMLYTYLEHDYKDY
IDLSVFNTVERLKTVTKNWDKTTQTEAERIAQDMYINERQKPLMKKLFVKFAIRTSFRVS
AILRVRWKDIQLDESTGHYIVTVIDKGSQVVSTGINQVFYEELLQLKEEDDSETELVFQG
LSEQSLRHSLKRSKKRLGIPPERELVLHSFKGVGIDYVYENSGHDLLAAKEQGNHKNTLT
TERYMSRKINIANSAGVTMDEKIDLNPLYEATQEDFISFFENADLVTLKKFIKHVNER
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaaattaaacaattaaaaaattatgcggtttacgatgatatcgagggcttt
ttaatcaataaagatataagaagtagctcagggaattctaactatatgatgccttcatca
actagaagggtgtcgaacaccagaaagaattatgaaggggatattaagcagttctttagt
gtgattaaaggtaaagatgtcaaaagtttagttcccgatgatttagttgtaagtaaaagc
gaattaagcaactatgtgaagtatcttcaggaaaagggattagttaataatagtattaac
agaaaaatgacctccttgaagatgctctatacatatttggagcatgattataaggactat
attgacttgtcggtgtttaatactgtcgaaaggcttaaaacagtaactaaaaactgggat
aaaacaacccagacagaagccgaaagaatcgctcaggatatgtatataaatgaaagacag
aaacctttaatgaaaaagctgtttgttaaattcgccatcagaacttcttttcgtgtaagt
gcgattttgcgagtaagatggaaagacatacagcttgatgaaagtacaggccattatata
gtaacagttattgataaaggatctcaggttgtgtctacaggcattaaccaggtattttat
gaggaattgttgcagctgaaggaagaggatgacagcgaaactgaattggtttttcagggg
ctttcggaacaatctttacgacactccttaaaaaggtcgaaaaaaaggttaggaatacct
cctgaaagagaattagtcttacactcatttaagggtgtaggaattgactatgtctatgag
aattctggtcacgatttacttgcagcaaaagaacaaggaaatcataaaaacacattaaca
acagagagatatatgagcagaaagattaacatagcgaactctgctggtgtaacaatggat
gaaaaaatcgatttaaatccactatatgaagcaacccaagaggattttattagttttttt
gaaaacgctgatcttgttacattaaaaaagtttataaagcatgtaaatgagcgataa

DBGET integrated database retrieval system