KEGG   Bacillus subtilis subsp. subtilis 168: BSU20830
Entry
BSU20830          CDS       T00010                                 

Gene name
yopN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 935916
NCBI-ProteinID: NP_389965
Pasteur: BG13647
BSORF: BG13647
UniProt: P68581 A0A6M3ZIR0
Position
complement(2208008..2208325)
AA seq 105 aa
MHVVELRSTNHKDIDADFVLNAKQTYIESVLNIRKMIVNAKTEDDLHGAKIEIAALLKDL
NRVLLGGDGLKRSIENNPHFRSLIHFVKNLKRHIAIEFEEFIYQP
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcatgttgtagaacttaggtctacaaatcataaagatattgatgccgattttgtatta
aatgctaaacaaacttacatagagagtgtactaaacattaggaaaatgattgttaatgca
aaaactgaagatgatctacatggtgcaaaaatagagatagcagcattattaaaagatcta
aatagagtattattaggtggagatggattaaaaagaagcattgaaaataatccgcatttt
agatccctaatacattttgtgaagaatttaaaacgacacattgcaattgaatttgaagag
tttatttatcaaccataa

DBGET integrated database retrieval system