KEGG   Bacillus subtilis subsp. subtilis 168: BSU20840
Entry
BSU20840          CDS       T00010                                 

Gene name
yopM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Morc6_S5
Other DBs
NCBI-GeneID: 939186
NCBI-ProteinID: NP_389966
Pasteur: BG13646
BSORF: BG13646
UniProt: O34605 A0A6M4JJP5
Position
complement(2208328..2208528)
AA seq 66 aa
MSAISYLKNSMTMHKTIYQKKVESLVKNDLFFHEKSIEKSKIMKNENVRKQLTKGYMKLL
SEYKED
NT seq 201 nt   +upstreamnt  +downstreamnt
atgtccgcaattagttacttaaaaaacagtatgacaatgcataaaaccatttaccaaaag
aaagttgaaagcttagttaaaaatgatttgttttttcatgaaaaaagcattgaaaagtca
aaaataatgaagaatgaaaatgttcgaaaacaactaactaaaggatacatgaaattgcta
agcgaatacaaggaggattaa

DBGET integrated database retrieval system