KEGG   Bacillus subtilis subsp. subtilis 168: BSU20850Help
Entry
BSU20850          CDS       T00010                                 

Gene name
yopL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939422
NCBI-ProteinID: NP_389967
Pasteur: BG13645
BSORF: BG13645
UniProt: O31926
Position
complement(2208855..2208980)
Genome map
AA seq 41 aa AA seqDB search
MKKLIMALVILGALGTSYISADSSIQQASGDYEVAGMPRGA
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttattatggctttagttatcttgggcgcactaggcacttcttacataagt
gcagattcttcaatccaacaagcttcaggtgattatgaggttgctggaatgccacgtgga
gcataa

DBGET integrated database retrieval system