KEGG   Bacillus subtilis subsp. subtilis 168: BSU20860Help
Entry
BSU20860          CDS       T00010                                 

Gene name
yopK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939187
NCBI-ProteinID: NP_389968
Pasteur: BG13644
BSORF: BG13644
UniProt: O31927
Structure
PDB: 

Position
complement(2208994..2210154)
Genome map
AA seq 386 aa AA seqDB search
MELIRIAMKKDLENDNSLMNKWATVAGLKNPNPLYDFLNHDGKTFNEFSSIVNIVKSQYP
DREYELMKDYCLNLDVKTKAARSALEYADANMFFEIEDVLIDSMISCSNMKSKEYGKVYK
IHRELSNSVITEFEAVKRLGKLNIKTPEMNSFSRLLLLYHYLSTGNFSPMAQLIKQIDLS
EISENMYIRNTYQTRVHVLMSNIKLNENSLEECREYSKKALESTNILRFQVFSYLTIGNS
LLFSNYELAQENFLKGLSISVQNENYNMIFQQALCFLNNVWRKENKWINFESDSIMDLQE
QAHCFINFNENSKAKEVLDKLDLLVHNDNELAMHYYLKGRLEQNKACFYSSIEYFKKSND
KFLIRLPLLELQKMGENQKLLELLLL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggagttaataaggatagctatgaagaaagacttggaaaatgacaactctttaatgaat
aaatgggcaacagtagctggccttaaaaaccccaatcctctttatgacttcttaaaccat
gatgggaaaacatttaatgaattttcttcaatagtcaacattgttaagagtcagtatcca
gaccgtgaatatgaattaatgaaagattactgtttaaacctagatgttaagacaaaggca
gcaagaagtgcattggagtatgctgatgcaaatatgttttttgaaatagaagatgtttta
atagattcaatgatttcttgcagcaatatgaaaagtaaagaatatggaaaagtgtataaa
atacatagagaactgtctaacagtgttattactgaatttgaggcagtgaaaagactcggc
aaattaaatataaaaacacctgaaatgaattctttctcaagactcttgctgctttatcat
tatttaagcactggtaacttttctccgatggcccaacttataaaacaaattgacctaagt
gagatttctgagaacatgtacattagaaatacatatcaaacaagagttcatgttctaatg
tctaatataaagttaaatgaaaattcattagaggagtgcagagagtactctaaaaaggca
ttggaaagtacaaatatcctgagatttcaggttttcagctacttaactattggcaactct
ctattattttcgaattatgaattggctcaagaaaactttttaaaagggctaagcatttct
gttcaaaatgaaaattacaacatgattttccagcaggctttgtgcttcttaaataatgta
tggcgcaaagaaaataagtggattaattttgaatctgattcaattatggatttgcaggag
caagctcattgttttatcaactttaatgaaaattccaaagcaaaagaagttttggataaa
ctagatcttttagttcacaacgataatgagcttgcaatgcattattatttgaaaggaaga
ctcgaacaaaataaagcatgtttctattcttcaatcgagtattttaaaaagtctaatgac
aaattccttattaggctgccactgttagaactgcaaaagatgggtgaaaatcaaaaactt
ttagaattacttttactttaa

DBGET integrated database retrieval system