KEGG   Bacillus subtilis subsp. subtilis 168: BSU20870Help
Entry
BSU20870          CDS       T00010                                 

Gene name
yopJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939184
NCBI-ProteinID: NP_389969
Pasteur: BG13643
BSORF: BG13643
UniProt: O31928
Position
complement(2210331..2210747)
Genome map
AA seq 138 aa AA seqDB search
MKNTFLYFRWEDLHGEIGVDSFNLLRASYSNLSEQQLVELIKELISIEREDIAAKFDIHL
SENAPVFDERQHVVYKGVAGDMNYKDMLLSLVTALDLTNTLDHVQNILSLAKCLRSFDRE
IFARFAKDIAEEVYYSLK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacacatttttatattttagatgggaagacctccatggtgaaataggtgttgat
tcctttaatttattgagagcaagttattctaatttgagtgaacagcaattagtagagtta
attaaagagttgatatctatagagcgggaggatatcgctgcgaaatttgatatacaccta
tctgagaatgccccagttttcgatgaacggcaacatgtggtttataaaggcgttgccgga
gatatgaactacaaagacatgttgctttctttggtaacggcattagatttgactaataca
cttgaccatgtgcagaatatcctgtccttagctaaatgcttaagaagttttgatagagaa
attttcgctaggtttgcaaaggatattgcggaagaggtgtattatagccttaagtag

DBGET integrated database retrieval system