KEGG   Bacillus subtilis subsp. subtilis 168: BSU20880Help
Entry
BSU20880          CDS       T00010                                 

Gene name
yopI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939182
NCBI-ProteinID: NP_389970
Pasteur: BG13642
BSORF: BG13642
UniProt: O31929
Position
complement(2210749..2211282)
Genome map
AA seq 177 aa AA seqDB search
MNNIGEIISNFEGIIGALLGVIVTLILTHILKHFGQIKFYIVDFEIYFKTDNDGWGTNVM
PSKDEAKQIEIHSQIEIYNGAEIPKVLREIKFCFYKNTNLIVSVTPDDKATTEEFAEFGY
YRDKLFNINLPSKQIIAINIIKFLNEKETKQVKKCNRVYLEAKDHNGKMYKVFLGEF
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatataggagaaataatttctaattttgaaggtatcattggggctttattggga
gttatagtcactttaattcttactcacatattaaagcactttgggcaaattaaattttat
atagttgactttgaaatatattttaaaaccgataatgatggttggggaactaatgttatg
ccatctaaagatgaagcaaagcaaatagaaatacactcccagattgaaatatacaatggc
gctgagatccccaaggttctacgggaaattaaattttgcttttacaaaaacacaaattta
attgtttctgttacccctgatgataaagcaacaactgaagagtttgctgagtttggctat
tacagggataagttatttaatattaatttgccttctaagcaaatcatcgctattaatata
ataaaatttttaaacgaaaaggaaactaaacaagtgaaaaaatgcaatagggtttatctt
gaggcaaaagatcataacgggaaaatgtacaaagtattcttaggggagttttaa

DBGET integrated database retrieval system