KEGG   Bacillus subtilis subsp. subtilis 168: BSU20890
Entry
BSU20890          CDS       T00010                                 

Gene name
yopH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SieB
Other DBs
NCBI-GeneID: 939185
NCBI-ProteinID: NP_389971
Pasteur: BG13641
BSORF: BG13641
UniProt: O31930 A0A6M4JI49
Position
complement(2211309..2211845)
AA seq 178 aa
MSDQNEKSPSWVGDIIKLSPKYLLGLAVFSGIGLWLGNVGLGKTLGIKDAINSYKLYLGL
VFLASTSFILSHFIWWISLGIKNKIDQKYSYKLQKERLRNLNRREKQILSPYIFDDVRSV
ELSITDGTAQELEHLKIIYRSSNISNRGSYFAYNIQPWARGYLTKNKHLLHESIDHIL
NT seq 537 nt   +upstreamnt  +downstreamnt
atgagtgaccaaaatgaaaaaagtccttcatgggtaggtgacattattaagctgagccct
aaatatttattgggactagcagttttttctggaattgggctttggttagggaatgttgga
ttaggaaaaacacttggtataaaagatgctataaatagctataaactttacctagggctt
gttttcttagcatcaaccagtttcattttatctcactttatttggtggataagtttgggg
ataaaaaataaaattgaccaaaaatacagttataaactgcaaaaagaaagactccgaaat
cttaataggagggaaaaacaaatattaagcccctacatctttgacgatgttcggtctgtg
gaattaagtataactgatgggacagctcaggaattagaacatttaaagattatttataga
agttctaatattagtaatcgtggttcttattttgcatacaacatacagccttgggcgagg
ggatatttaacaaaaaacaagcatttattacatgagtcaatagatcacatcttataa

DBGET integrated database retrieval system